Lineage for d3zxwd_ (3zxw D:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1208801Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
    alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta
  4. 1208802Superfamily d.73.1: RuBisCO, small subunit [55239] (1 family) (S)
  5. 1208803Family d.73.1.1: RuBisCO, small subunit [55240] (2 proteins)
  6. 1208961Protein automated matches [190066] (5 species)
    not a true protein
  7. 1209030Species Thermosynechococcus elongatus [TaxId:197221] [193543] (1 PDB entry)
  8. 1209031Domain d3zxwd_: 3zxw D: [193544]
    automated match to d1rsci_
    complexed with cap, gol, mg

Details for d3zxwd_

PDB Entry: 3zxw (more details), 2.1 Å

PDB Description: structure of activated rubisco from thermosynechococcus elongatus complexed with 2-carboxyarabinitol-1,5-diphosphate
PDB Compounds: (D:) ribulose bisphosphate carboxylase small chain

SCOPe Domain Sequences for d3zxwd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zxwd_ d.73.1.1 (D:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
sylpplsdaqiarqiqyaidqgyhpcvefnetsnaeirywtmwklplfnctnaqdvlnev
qqcrseypncfirvvafdnikqcqvmsfivykp

SCOPe Domain Coordinates for d3zxwd_:

Click to download the PDB-style file with coordinates for d3zxwd_.
(The format of our PDB-style files is described here.)

Timeline for d3zxwd_: