Lineage for d4f49b_ (4f49 B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2794585Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2797303Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins)
  6. 2797364Protein Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) [74979] (8 species)
    contains an extra alpha-helical domain
  7. 2797387Species Porcine transmissible gastroenteritis coronavirus [TaxId:11151] [193539] (1 PDB entry)
  8. 2797389Domain d4f49b_: 4f49 B: [193540]
    Other proteins in same PDB: d4f49a2, d4f49c2, d4f49d2
    automated match to d1lvod_
    complexed with k36, pg4
    has additional subdomain(s) that are not in the common domain

Details for d4f49b_

PDB Entry: 4f49 (more details), 2.25 Å

PDB Description: 2.25a resolution structure of transmissible gastroenteritis virus protease containing a covalently bound dipeptidyl inhibitor
PDB Compounds: (B:) 3C-like proteinase

SCOPe Domain Sequences for d4f49b_:

Sequence, based on SEQRES records: (download)

>d4f49b_ b.47.1.4 (B:) Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) {Porcine transmissible gastroenteritis coronavirus [TaxId: 11151]}
sglrkmaqpsglvepcivrvsygnnvlnglwlgdevicprhviasdttrvinyenemssv
rlhnfsvsknnvflgvvsarykgvnlvlkvnqvnpntpehkfksikagesfnilacyegc
pgsvygvnmrsqgtikgsfiagtcgsvgyvlengilyfvymhhlelgngshvgsnfegem
yggyedqpsmqlegtnvmssdnvvaflyaalingerwfvtntsmslesyntwaktnsfte
lsstdafsmlaaktgqsveklldsivrlnkgfggrtilsygslcdeftptevirqmyg

Sequence, based on observed residues (ATOM records): (download)

>d4f49b_ b.47.1.4 (B:) Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) {Porcine transmissible gastroenteritis coronavirus [TaxId: 11151]}
sglrkmaqpsglvepcivrvsygnnvlnglwlgdevicprhviasdttrvinyenemssv
rlhnfsvsknnvflgvvsarykgvnlvlkvnqvnpntpehkfksikagesfnilacyegc
pgsvygvnmrsqgtikgsfiagtcgsvgyvlengilyfvymhhlelgngshvgsnfegem
yggyedqpsmqlegtnvmssdnvvaflyaalingerwfvtntsmslesyntwaktnsfte
lstdafsmlaaktgqsveklldsivrlnkgfggrtilsygslcdeftptevirqmyg

SCOPe Domain Coordinates for d4f49b_:

Click to download the PDB-style file with coordinates for d4f49b_.
(The format of our PDB-style files is described here.)

Timeline for d4f49b_: