Class b: All beta proteins [48724] (180 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins) |
Protein Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) [74979] (8 species) contains an extra alpha-helical domain |
Species Porcine transmissible gastroenteritis coronavirus [TaxId:11151] [193539] (1 PDB entry) |
Domain d4f49b_: 4f49 B: [193540] Other proteins in same PDB: d4f49a2, d4f49c2, d4f49d2 automated match to d1lvod_ complexed with k36, pg4 has additional subdomain(s) that are not in the common domain |
PDB Entry: 4f49 (more details), 2.25 Å
SCOPe Domain Sequences for d4f49b_:
Sequence, based on SEQRES records: (download)
>d4f49b_ b.47.1.4 (B:) Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) {Porcine transmissible gastroenteritis coronavirus [TaxId: 11151]} sglrkmaqpsglvepcivrvsygnnvlnglwlgdevicprhviasdttrvinyenemssv rlhnfsvsknnvflgvvsarykgvnlvlkvnqvnpntpehkfksikagesfnilacyegc pgsvygvnmrsqgtikgsfiagtcgsvgyvlengilyfvymhhlelgngshvgsnfegem yggyedqpsmqlegtnvmssdnvvaflyaalingerwfvtntsmslesyntwaktnsfte lsstdafsmlaaktgqsveklldsivrlnkgfggrtilsygslcdeftptevirqmyg
>d4f49b_ b.47.1.4 (B:) Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) {Porcine transmissible gastroenteritis coronavirus [TaxId: 11151]} sglrkmaqpsglvepcivrvsygnnvlnglwlgdevicprhviasdttrvinyenemssv rlhnfsvsknnvflgvvsarykgvnlvlkvnqvnpntpehkfksikagesfnilacyegc pgsvygvnmrsqgtikgsfiagtcgsvgyvlengilyfvymhhlelgngshvgsnfegem yggyedqpsmqlegtnvmssdnvvaflyaalingerwfvtntsmslesyntwaktnsfte lstdafsmlaaktgqsveklldsivrlnkgfggrtilsygslcdeftptevirqmyg
Timeline for d4f49b_: