Lineage for d3tnva_ (3tnv A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2196354Superfamily d.58.10: Acylphosphatase/BLUF domain-like [54975] (3 families) (S)
  5. 2196355Family d.58.10.1: Acylphosphatase-like [54976] (4 proteins)
    automatically mapped to Pfam PF00708
  6. 2196375Protein automated matches [191024] (3 species)
    not a true protein
  7. 2196383Species Pyrococcus horikoshii OT3 [TaxId:70601] [193532] (1 PDB entry)
  8. 2196384Domain d3tnva_: 3tnv A: [193533]
    automated match to d1w2ia_
    complexed with po4

Details for d3tnva_

PDB Entry: 3tnv (more details), 1.6 Å

PDB Description: Acylphosphatase with thermophilic surface and mesophilic core
PDB Compounds: (A:) acylphosphatase

SCOPe Domain Sequences for d3tnva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tnva_ d.58.10.1 (A:) automated matches {Pyrococcus horikoshii OT3 [TaxId: 70601]}
aivrvhykiygrvqgvgfrwstqregrklglngwvrnlpdgsvegvlegdeerveamigw
lhqgpplarvtrvevkweqpkgekgfrivg

SCOPe Domain Coordinates for d3tnva_:

Click to download the PDB-style file with coordinates for d3tnva_.
(The format of our PDB-style files is described here.)

Timeline for d3tnva_: