![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.10: Acylphosphatase/BLUF domain-like [54975] (3 families) ![]() |
![]() | Family d.58.10.1: Acylphosphatase-like [54976] (4 proteins) automatically mapped to Pfam PF00708 |
![]() | Protein automated matches [191024] (3 species) not a true protein |
![]() | Species Pyrococcus horikoshii OT3 [TaxId:70601] [193532] (1 PDB entry) |
![]() | Domain d3tnva_: 3tnv A: [193533] automated match to d1w2ia_ complexed with po4 |
PDB Entry: 3tnv (more details), 1.6 Å
SCOPe Domain Sequences for d3tnva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tnva_ d.58.10.1 (A:) automated matches {Pyrococcus horikoshii OT3 [TaxId: 70601]} aivrvhykiygrvqgvgfrwstqregrklglngwvrnlpdgsvegvlegdeerveamigw lhqgpplarvtrvevkweqpkgekgfrivg
Timeline for d3tnva_: