SCOPe 2.02: Domain d3tnva_: 3tnv A:

Lineage for d3tnva_ (3tnv A:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.10: Acylphosphatase/BLUF domain-like [54975] (3 families)

5. Family d.58.10.1: Acylphosphatase-like [54976] (4 proteins)

6. Protein automated matches [191024] (3 species)
   not a true protein

7. Species Pyrococcus horikoshii [TaxId:70601] [193532] (1 PDB entry)

8. Domain d3tnva_: 3tnv A: [193533]
   automated match to d1w2ia_
   complexed with po4

Details for d3tnva_

PDB Entry: 3tnv, 1.6 Å

PDB Description: Acylphosphatase with thermophilic surface and mesophilic core

PDB Compounds: (A:) acylphosphatase

SCOPe Domain Sequences for d3tnva_:

Sequence; same for both SEQRES and ATOM records:

>d3tnva_ d.58.10.1 (A:) automated matches {Pyrococcus horikoshii [TaxId: 70601]}
aivrvhykiygrvqgvgfrwstqregrklglngwvrnlpdgsvegvlegdeerveamigw
lhqgpplarvtrvevkweqpkgekgfrivg

Timeline for d3tnva_:

• d3tnva_ is new in SCOPe 2.02-stable
  
• d3tnva_ appears in SCOPe 2.03
  
• d3tnva_ appears in the current release, SCOPe 2.08