SCOPe 2.05: Domain d1bm0b3: 1bm0 B:389-582

Lineage for d1bm0b3 (1bm0 B:389-582)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.126: Serum albumin-like [48551] (1 superfamily)
   multihelical; one domain consists of two similar disulfide-linked subdomains

4. Superfamily a.126.1: Serum albumin-like [48552] (2 families)

5. Family a.126.1.1: Serum albumin-like [48553] (2 proteins)

6. Protein Serum albumin [48554] (1 species)
   duplication: consists of three domains of this fold

7. Species Human (Homo sapiens) [TaxId:9606] [48555] (70 PDB entries)
   Uniprot P02768 29-596

8. Domain d1bm0b3: 1bm0 B:389-582 [19353]

Details for d1bm0b3

PDB Entry: 1bm0, 2.5 Å

PDB Description: crystal structure of human serum albumin

PDB Compounds: (B:) serum albumin

SCOPe Domain Sequences for d1bm0b3:

Sequence; same for both SEQRES and ATOM records:

>d1bm0b3 a.126.1.1 (B:389-582) Serum albumin {Human (Homo sapiens) [TaxId: 9606]}
kqncelfeqlgeykfqnallvrytkkvpqvstptlvevsrnlgkvgskcckhpeakrmpc
aedylsvvlnqlcvlhektpvsdrvtkccteslvnrrpcfsalevdetyvpkefnaetft
fhadictlsekerqikkqtalvelvkhkpkatkeqlkavmddfaafvekcckaddketcf
aeegkklvaasqaa

Timeline for d1bm0b3:

• d1bm0b3 first appeared (with stable ids) in SCOP 1.55
  
• d1bm0b3 appears in SCOPe 2.04
  
• d1bm0b3 appears in SCOPe 2.06
  
• d1bm0b3 appears in the current release, SCOPe 2.08