Lineage for d1bm0b3 (1bm0 B:389-582)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 6463Fold a.126: Serum albumin [48551] (1 superfamily)
  4. 6464Superfamily a.126.1: Serum albumin [48552] (1 family) (S)
  5. 6465Family a.126.1.1: Serum albumin [48553] (1 protein)
  6. 6466Protein Serum albumin [48554] (1 species)
  7. 6467Species Human (Homo sapiens) [TaxId:9606] [48555] (13 PDB entries)
  8. 6473Domain d1bm0b3: 1bm0 B:389-582 [19353]

Details for d1bm0b3

PDB Entry: 1bm0 (more details), 2.5 Å

PDB Description: crystal structure of human serum albumin

SCOP Domain Sequences for d1bm0b3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bm0b3 a.126.1.1 (B:389-582) Serum albumin {Human (Homo sapiens)}
kqncelfeqlgeykfqnallvrytkkvpqvstptlvevsrnlgkvgskcckhpeakrmpc
aedylsvvlnqlcvlhektpvsdrvtkccteslvnrrpcfsalevdetyvpkefnaetft
fhadictlsekerqikkqtalvelvkhkpkatkeqlkavmddfaafvekcckaddketcf
aeegkklvaasqaa

SCOP Domain Coordinates for d1bm0b3:

Click to download the PDB-style file with coordinates for d1bm0b3.
(The format of our PDB-style files is described here.)

Timeline for d1bm0b3: