Lineage for d4grdd_ (4grd D:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2438294Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2439847Superfamily c.23.8: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) [52255] (2 families) (S)
  5. 2439958Family c.23.8.0: automated matches [191522] (1 protein)
    not a true family
  6. 2439959Protein automated matches [190879] (8 species)
    not a true protein
  7. 2439981Species Burkholderia cenocepacia [TaxId:216591] [193525] (1 PDB entry)
  8. 2439985Domain d4grdd_: 4grd D: [193526]
    automated match to d3oowg_

Details for d4grdd_

PDB Entry: 4grd (more details), 1.85 Å

PDB Description: crystal structure of phosphoribosylaminoimidazole carboxylase catalytic subunit from burkholderia cenocepacia j2315
PDB Compounds: (D:) Phosphoribosylaminoimidazole carboxylase catalytic subunit

SCOPe Domain Sequences for d4grdd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4grdd_ c.23.8.0 (D:) automated matches {Burkholderia cenocepacia [TaxId: 216591]}
tahthsaplvgvlmgsssdwdvmkhavailqefgvpyeakvvsahrmpdemfdyaekare
rglraiiagaggaahlpgmlaakttvpvlgvpvaskylkgvdslhsivqmpkgvpvatfa
igeagaanaalfavsilsgnsvdyanrlaafrvrqneaahamvlpple

SCOPe Domain Coordinates for d4grdd_:

Click to download the PDB-style file with coordinates for d4grdd_.
(The format of our PDB-style files is described here.)

Timeline for d4grdd_: