Lineage for d1bm0b2 (1bm0 B:197-388)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2343304Fold a.126: Serum albumin-like [48551] (1 superfamily)
    multihelical; one domain consists of two similar disulfide-linked subdomains
  4. 2343305Superfamily a.126.1: Serum albumin-like [48552] (2 families) (S)
  5. 2343306Family a.126.1.1: Serum albumin-like [48553] (2 proteins)
  6. 2343307Protein Serum albumin [48554] (1 species)
    duplication: consists of three domains of this fold
  7. 2343308Species Human (Homo sapiens) [TaxId:9606] [48555] (93 PDB entries)
    Uniprot P02768 29-596
  8. 2343418Domain d1bm0b2: 1bm0 B:197-388 [19352]

Details for d1bm0b2

PDB Entry: 1bm0 (more details), 2.5 Å

PDB Description: crystal structure of human serum albumin
PDB Compounds: (B:) serum albumin

SCOPe Domain Sequences for d1bm0b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bm0b2 a.126.1.1 (B:197-388) Serum albumin {Human (Homo sapiens) [TaxId: 9606]}
rlkcaslqkfgerafkawavarlsqrfpkaefaevsklvtdltkvhtecchgdllecadd
radlakyicenqdsissklkeccekpllekshciaevendempadlpslaadfveskdvc
knyaeakdvflgmflyeyarrhpdysvvlllrlaktyettlekccaaadphecyakvfde
fkplveepqnli

SCOPe Domain Coordinates for d1bm0b2:

Click to download the PDB-style file with coordinates for d1bm0b2.
(The format of our PDB-style files is described here.)

Timeline for d1bm0b2: