SCOPe 2.06: Domain d1bm0b2: 1bm0 B:197-388

Lineage for d1bm0b2 (1bm0 B:197-388)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.126: Serum albumin-like [48551] (1 superfamily)
   multihelical; one domain consists of two similar disulfide-linked subdomains

4. Superfamily a.126.1: Serum albumin-like [48552] (2 families)

5. Family a.126.1.1: Serum albumin-like [48553] (2 proteins)

6. Protein Serum albumin [48554] (1 species)
   duplication: consists of three domains of this fold

7. Species Human (Homo sapiens) [TaxId:9606] [48555] (78 PDB entries)
   Uniprot P02768 29-596

8. Domain d1bm0b2: 1bm0 B:197-388 [19352]

Details for d1bm0b2

PDB Entry: 1bm0, 2.5 Å

PDB Description: crystal structure of human serum albumin

PDB Compounds: (B:) serum albumin

SCOPe Domain Sequences for d1bm0b2:

Sequence; same for both SEQRES and ATOM records:

>d1bm0b2 a.126.1.1 (B:197-388) Serum albumin {Human (Homo sapiens) [TaxId: 9606]}
rlkcaslqkfgerafkawavarlsqrfpkaefaevsklvtdltkvhtecchgdllecadd
radlakyicenqdsissklkeccekpllekshciaevendempadlpslaadfveskdvc
knyaeakdvflgmflyeyarrhpdysvvlllrlaktyettlekccaaadphecyakvfde
fkplveepqnli

Timeline for d1bm0b2:

• d1bm0b2 first appeared (with stable ids) in SCOP 1.55
  
• d1bm0b2 appears in SCOPe 2.05
  
• d1bm0b2 appears in SCOPe 2.07
  
• d1bm0b2 appears in the current release, SCOPe 2.08