SCOPe 2.04: Domain d4gdib_: 4gdi B:

Lineage for d4gdib_ (4gdi B:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
   consists of six 4-stranded beta-sheet motifs; meander

4. Superfamily b.68.1: Sialidases [50939] (3 families)

5. Family b.68.1.0: automated matches [191452] (1 protein)
   not a true family

6. Protein automated matches [190692] (9 species)
   not a true protein

7. Species Influenza A virus [TaxId:11320] [188445] (31 PDB entries)

8. Domain d4gdib_: 4gdi B: [193498]
   automated match to d3b7ea_
   complexed with ca, gol, nag, no3

Details for d4gdib_

PDB Entry: 4gdi, 1.95 Å

PDB Description: a subtype n10 neuraminidase-like protein of a/little yellow-shouldered bat/guatemala/164/2009

PDB Compounds: (B:) Neuraminidase

SCOPe Domain Sequences for d4gdib_:

Sequence; same for both SEQRES and ATOM records:

>d4gdib_ b.68.1.0 (B:) automated matches {Influenza A virus [TaxId: 11320]}
fywraksqmcevkgwvpthrgfpwgpelpgdlilsrrayvscdltscfkffiayglsanq
hllntsmeweeslyktpigsastlstsemilpgrsssacfdglkwtvlvangrdrnsfim
ikygeevtdtfsasrggplrlpnseciciegscfvivsdgpnvnqsvhriyelqngtvqr
wkqlnttginfeystcytinnlikctgtnlwndakrpllrftkelnyqivepcngaptdf
prgglttpsckmaqekgeggiqgfildekpawtsktkaessqngfvleqipngiesegtv
slsyelfsnkrtgrsgffqpkgdlisgcqricfwleiedqtvglgmiqelstfcginspv
qninwds

Timeline for d4gdib_:

• d4gdib_ first appeared in SCOPe 2.02
  
• d4gdib_ appears in SCOPe 2.03
  
• d4gdib_ appears in SCOPe 2.05
  
• d4gdib_ appears in the current release, SCOPe 2.08