Lineage for d4h3dd1 (4h3d D:1-254)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2085156Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2086456Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2086457Protein automated matches [190115] (75 species)
    not a true protein
  7. 2086607Species Clostridium difficile [TaxId:272563] [189051] (2 PDB entries)
  8. 2086611Domain d4h3dd1: 4h3d D:1-254 [193493]
    Other proteins in same PDB: d4h3dd2
    automated match to d3js3a_
    complexed with act, peg, pge, shl

Details for d4h3dd1

PDB Entry: 4h3d (more details), 1.95 Å

PDB Description: 1.95 angstrom crystal structure of of type i 3-dehydroquinate dehydratase (arod) from clostridium difficile with covalent modified comenic acid.
PDB Compounds: (D:) 3-dehydroquinate dehydratase

SCOPe Domain Sequences for d4h3dd1:

Sequence, based on SEQRES records: (download)

>d4h3dd1 c.1.10.0 (D:1-254) automated matches {Clostridium difficile [TaxId: 272563]}
mkrkvqvknitigegrpkicvpiigknkkdiikeakelkdacldiiewrvdffenvenik
evkevlyelrsyihdipllftfrsvveggeklisrdyyttlnkeisntglvdlidvelfm
gdevidevvnfahkkevkviisnhdfnktpkkeeivsrlcrmqelgadlpkiavmpqnek
dvlvlleatnemfkiyadrpiitmsmsgmgvisrlcgeifgsaltfgaaksvsapgqisf
kelnsvlnllhksi

Sequence, based on observed residues (ATOM records): (download)

>d4h3dd1 c.1.10.0 (D:1-254) automated matches {Clostridium difficile [TaxId: 272563]}
mkrkvqvknitigegrpkicvpiigknkkdiikeakelkdacldiiewrvdffenvenik
evkevlyelrsyihdipllftfrsvveggeklisrdyyttlnkeisntglvdlidvelfm
gdevidevvnfahkkevkviisnhdfnktpkkeeivsrlcrmqelgadlpkiavmpqnek
dvlvlleatnemfkiyadrpiitmsmsgmgvisrlcgeifgsaltfgaaksapgqisfke
lnsvlnllhksi

SCOPe Domain Coordinates for d4h3dd1:

Click to download the PDB-style file with coordinates for d4h3dd1.
(The format of our PDB-style files is described here.)

Timeline for d4h3dd1: