SCOP 1.65: Domain d1bm0a1: 1bm0 A:5-196

Lineage for d1bm0a1 (1bm0 A:5-196)

1. Root: SCOP 1.65

2. Class a: All alpha proteins [46456] (179 folds)

3. Fold a.126: Serum albumin-like [48551] (1 superfamily)
   multihelical; one domain consists of two similar disulphide-linked subdomains

4. Superfamily a.126.1: Serum albumin-like [48552] (1 family)

5. Family a.126.1.1: Serum albumin-like [48553] (2 proteins)

6. Protein Serum albumin [48554] (1 species)
   duplication: consists of three domains of this fold

7. Species Human (Homo sapiens) [TaxId:9606] [48555] (25 PDB entries)

8. Domain d1bm0a1: 1bm0 A:5-196 [19348]

Details for d1bm0a1

PDB Entry: 1bm0, 2.5 Å

PDB Description: crystal structure of human serum albumin

SCOP Domain Sequences for d1bm0a1:

Sequence; same for both SEQRES and ATOM records:

>d1bm0a1 a.126.1.1 (A:5-196) Serum albumin {Human (Homo sapiens)}
sevahrfkdlgeenfkalvliafaqylqqcpfedhvklvnevtefaktcvadesaencdk
slhtlfgdklctvatlretygemadccakqepernecflqhkddnpnlprlvrpevdvmc
tafhdneetflkkylyeiarrhpyfyapellffakrykaafteccqaadkaacllpklde
lrdegkassakq

Timeline for d1bm0a1:

• d1bm0a1 first appeared (with stable ids) in SCOP 1.55
  
• d1bm0a1 appears in SCOP 1.63
  
• d1bm0a1 appears in SCOP 1.67
  
• d1bm0a1 appears in the current release, SCOPe 2.08