Lineage for d3zr4f_ (3zr4 F:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1356042Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1358417Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 1358418Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (12 proteins)
    contains a catalytic Cys-His-Glu triad
  6. 1358493Protein GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF [69447] (3 species)
  7. 1358503Species Thermotoga maritima [TaxId:2336] [69448] (5 PDB entries)
  8. 1358506Domain d3zr4f_: 3zr4 F: [193474]
    Other proteins in same PDB: d3zr4a_, d3zr4c_, d3zr4e_
    automated match to d1gpwd_
    complexed with gln, gol

Details for d3zr4f_

PDB Entry: 3zr4 (more details), 2.41 Å

PDB Description: structural evidence for ammonia tunneling across the (beta-alpha)8 barrel of the imidazole glycerol phosphate synthase bienzyme complex
PDB Compounds: (F:) imidazole glycerol phosphate synthase subunit hish

SCOPe Domain Sequences for d3zr4f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zr4f_ c.23.16.1 (F:) GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima [TaxId: 2336]}
mrigiisvgpgnimnlyrgvkrasenfedvsielvesprndlydllfipgvghfgegmrr
lrendlidfvrkhvederyvvgvclgmqllfeeseeapgvkglsliegnvvklrsrrlph
mgwnevifkdtfpngyyyfvhtyravceeehvlgtteydgeifpsavrkgrilgfqfhpe
ksskigrkllekviecslsrr

SCOPe Domain Coordinates for d3zr4f_:

Click to download the PDB-style file with coordinates for d3zr4f_.
(The format of our PDB-style files is described here.)

Timeline for d3zr4f_: