| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) ![]() conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures |
| Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (12 proteins) contains a catalytic Cys-His-Glu triad |
| Protein GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF [69447] (3 species) |
| Species Thermotoga maritima [TaxId:2336] [69448] (5 PDB entries) |
| Domain d3zr4f_: 3zr4 F: [193474] Other proteins in same PDB: d3zr4a_, d3zr4c_, d3zr4e_ automated match to d1gpwd_ complexed with gln, gol |
PDB Entry: 3zr4 (more details), 2.41 Å
SCOPe Domain Sequences for d3zr4f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3zr4f_ c.23.16.1 (F:) GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima [TaxId: 2336]}
mrigiisvgpgnimnlyrgvkrasenfedvsielvesprndlydllfipgvghfgegmrr
lrendlidfvrkhvederyvvgvclgmqllfeeseeapgvkglsliegnvvklrsrrlph
mgwnevifkdtfpngyyyfvhtyravceeehvlgtteydgeifpsavrkgrilgfqfhpe
ksskigrkllekviecslsrr
Timeline for d3zr4f_: