SCOP 1.73: Domain d1f0jb_: 1f0j B:

Lineage for d1f0jb_ (1f0j B:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (5 families)

5. Family a.211.1.2: PDEase [48548] (6 proteins)
   Pfam PF00233; multihelical; can be divided into three subdomains

6. Protein Catalytic domain of cyclic nucleotide phosphodiesterase 4b2b [48549] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48550] (14 PDB entries)

8. Domain d1f0jb_: 1f0j B: [19347]
   complexed with ars, mg, zn; mutant

Details for d1f0jb_

PDB Entry: 1f0j, 1.77 Å

PDB Description: catalytic domain of human phosphodiesterase 4b2b

PDB Compounds: (B:) phosphodiesterase 4b

SCOP Domain Sequences for d1f0jb_:

Sequence; same for both SEQRES and ATOM records:

>d1f0jb_ a.211.1.2 (B:) Catalytic domain of cyclic nucleotide phosphodiesterase 4b2b {Human (Homo sapiens) [TaxId: 9606]}
sisrfgvntenedhlakeledlnkwglnifnvagyshnrpltcimyaifqerdllktfri
ssdtfitymmtledhyhsdvayhnslhaadvaqsthvllstpaldavftdleilaaifaa
aihdvdhpgvsnqflintnselalmyndesvlenhhlavgfkllqeehcdifmnltkkqr
qtlrkmvidmvlatdmskhmslladlktmvetkkvtssgvllldnytdriqvlrnmvhca
dlsnptkslelyrqwtdrimeeffqqgdkerergmeispmcdkhtasveksqvgfidyiv
hplwetwadlvqpdaqdildtlednrnwyqsmipqap

Timeline for d1f0jb_:

• d1f0jb_ first appeared (with stable ids) in SCOP 1.55
  
• d1f0jb_ appears in SCOP 1.71
  
• d1f0jb_ appears in SCOP 1.75
  
• d1f0jb_ appears in the current release, SCOPe 2.08