![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
![]() | Superfamily a.39.1: EF-hand [47473] (12 families) ![]() Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
![]() | Family a.39.1.2: S100 proteins [47478] (2 proteins) dimer: subunits are made of two EF-hands |
![]() | Protein automated matches [190132] (4 species) not a true protein |
![]() | Species Cow (Bos taurus) [TaxId:9913] [193459] (1 PDB entry) |
![]() | Domain d4fqoa_: 4fqo A: [193460] automated match to d3llea_ complexed with az3, ca |
PDB Entry: 4fqo (more details), 1.65 Å
SCOPe Domain Sequences for d4fqoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4fqoa_ a.39.1.2 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]} mselekavvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmet ldsdgdgecdfqefmafvamittacheff
Timeline for d4fqoa_: