Lineage for d4fqoa_ (4fqo A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2710067Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2710100Family a.39.1.2: S100 proteins [47478] (2 proteins)
    dimer: subunits are made of two EF-hands
  6. 2710348Protein automated matches [190132] (4 species)
    not a true protein
  7. 2710349Species Cow (Bos taurus) [TaxId:9913] [193459] (1 PDB entry)
  8. 2710350Domain d4fqoa_: 4fqo A: [193460]
    automated match to d3llea_
    complexed with az3, ca

Details for d4fqoa_

PDB Entry: 4fqo (more details), 1.65 Å

PDB Description: crystal structure of calcium-loaded s100b bound to sbi4211
PDB Compounds: (A:) Protein S100-B

SCOPe Domain Sequences for d4fqoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fqoa_ a.39.1.2 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
mselekavvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmet
ldsdgdgecdfqefmafvamittacheff

SCOPe Domain Coordinates for d4fqoa_:

Click to download the PDB-style file with coordinates for d4fqoa_.
(The format of our PDB-style files is described here.)

Timeline for d4fqoa_: