Lineage for d3uwva_ (3uwv A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1336839Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) (S)
  5. 1336840Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (2 proteins)
    automatically mapped to Pfam PF00121
  6. 1336841Protein Triosephosphate isomerase [51353] (20 species)
  7. 1336999Species Staphylococcus aureus [TaxId:282458] [189897] (6 PDB entries)
  8. 1337002Domain d3uwva_: 3uwv A: [193441]
    automated match to d3m9ya_
    complexed with 2pg, na

Details for d3uwva_

PDB Entry: 3uwv (more details), 2.07 Å

PDB Description: Crystal structure of Staphylococcus Aureus triosephosphate isomerase complexed with 2-phosphoglyceric acid
PDB Compounds: (A:) triosephosphate isomerase

SCOPe Domain Sequences for d3uwva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3uwva_ c.1.1.1 (A:) Triosephosphate isomerase {Staphylococcus aureus [TaxId: 282458]}
gsmrtpiiagnwkmnktvqeakdfvnalptlpdskevesvicapaiqldalttavkegka
qgleigaqntyfedngaftgetspvaladlgvkyvvighserrelfhetdeeinkkahai
fkhgmtpiicvgetdeeresgkandvvgeqvkkavaglsedqlksvviayepiwaigtgk
sstsedanemcafvrqtiadlsskevseatriqyggsvkpnnikeymaqtdidgalvgga
slkvedfvqllegak

SCOPe Domain Coordinates for d3uwva_:

Click to download the PDB-style file with coordinates for d3uwva_.
(The format of our PDB-style files is described here.)

Timeline for d3uwva_: