Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.42: POZ domain [54694] (1 superfamily) core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143 |
Superfamily d.42.1: POZ domain [54695] (3 families) |
Family d.42.1.1: BTB/POZ domain [54696] (6 proteins) |
Protein Elongin C [54699] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [54700] (19 PDB entries) |
Domain d4b95h_: 4b95 H: [193440] Other proteins in same PDB: d4b95a_, d4b95c_, d4b95d_, d4b95f_, d4b95g_, d4b95i_, d4b95j_, d4b95l_ automated match to d1lm8c_ complexed with act, uck |
PDB Entry: 4b95 (more details), 2.8 Å
SCOPe Domain Sequences for d4b95h_:
Sequence, based on SEQRES records: (download)
>d4b95h_ d.42.1.1 (H:) Elongin C {Human (Homo sapiens) [TaxId: 9606]} myvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcmy ftykvrytnssteipefpiapeialellmaanfldc
>d4b95h_ d.42.1.1 (H:) Elongin C {Human (Homo sapiens) [TaxId: 9606]} myvklissdghefivkrehaltsgtikamlsgnevnfreipshvlskvcmyftykvrytn ssteipefpiapeialellmaanfldc
Timeline for d4b95h_: