Lineage for d1qm6b1 (1qm6 B:1-249)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 50962Fold a.124: Phospholipase C/P1 nuclease [48536] (1 superfamily)
  4. 50963Superfamily a.124.1: Phospholipase C/P1 nuclease [48537] (2 families) (S)
  5. 50964Family a.124.1.1: Phospholipase C [48538] (2 proteins)
  6. 50965Protein Alpha-toxin, N-terminal domain [48541] (1 species)
  7. 50966Species Clostridium perfringens [TaxId:1502] [48542] (3 PDB entries)
  8. 50971Domain d1qm6b1: 1qm6 B:1-249 [19344]
    Other proteins in same PDB: d1qm6a2, d1qm6b2

Details for d1qm6b1

PDB Entry: 1qm6 (more details), 2.5 Å

PDB Description: closed form of clostridium perfringens alpha-toxin strain nctc8237

SCOP Domain Sequences for d1qm6b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qm6b1 a.124.1.1 (B:1-249) Alpha-toxin, N-terminal domain {Clostridium perfringens}
wdgkidgtgthamivtqgvsilendlsknepesvrknleilkenmhelqlgstypdydkn
aydlyqdhfwdpdtdnnfskdnswylaysipdtgesqirkfsalaryewqrgnykqatfy
lgeamhyfgdidtpyhpanvtavdsaghvkfetfaeerkeqykintagcktneafytdil
knkdfnawskeyargfaktgksiyyshasmshswddwdyaakvtlansqkgtagyiyrfl
hdvsegndp

SCOP Domain Coordinates for d1qm6b1:

Click to download the PDB-style file with coordinates for d1qm6b1.
(The format of our PDB-style files is described here.)

Timeline for d1qm6b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qm6b2