| Class b: All beta proteins [48724] (176 folds) |
| Fold b.3: Prealbumin-like [49451] (7 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.3: VHL [49468] (1 family) ![]() automatically mapped to Pfam PF01847 |
| Family b.3.3.1: VHL [49469] (2 proteins) |
| Protein automated matches [193392] (1 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [193393] (7 PDB entries) |
| Domain d4b95i_: 4b95 I: [193439] Other proteins in same PDB: d4b95a_, d4b95b_, d4b95c_, d4b95d_, d4b95e_, d4b95f_, d4b95g_, d4b95h_, d4b95j_, d4b95k_, d4b95l_ automated match to d1lm8v_ complexed with act, uck |
PDB Entry: 4b95 (more details), 2.8 Å
SCOPe Domain Sequences for d4b95i_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4b95i_ b.3.3.1 (I:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfrd
agthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrldiv
rslyedledhpnvqkdlerltqer
Timeline for d4b95i_: