SCOPe 2.02: Domain d4b95i_: 4b95 I:

Lineage for d4b95i_ (4b95 I:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.3: Prealbumin-like [49451] (7 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.3: VHL [49468] (1 family)

5. Family b.3.3.1: VHL [49469] (2 proteins)

6. Protein automated matches [193392] (1 species)
   not a true protein

7. Species Homo sapiens [TaxId:9606] [193393] (3 PDB entries)

8. Domain d4b95i_: 4b95 I: [193439]
   Other proteins in same PDB: d4b95h_, d4b95j_
   automated match to d1lm8v_
   complexed with act, uck

Details for d4b95i_

PDB Entry: 4b95

PDB Description: pvhl-elob-elob-eloc complex_(2s,4r)-1-(2-chlorophenyl)carbonyl-n-[(4- chlorophenyl)methyl]-4-oxidanyl-pyrrolidine-2-carboxamide bound

PDB Compounds: (I:) von hippel-lindau disease tumor suppressor

SCOPe Domain Sequences for d4b95i_:

Sequence; same for both SEQRES and ATOM records:

>d4b95i_ b.3.3.1 (I:) automated matches {Homo sapiens [TaxId: 9606]}
vlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfrd
agthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrldiv
rslyedledhpnvqkdlerltqer

Timeline for d4b95i_:

• d4b95i_ is new in SCOPe 2.02-stable
  
• d4b95i_ appears in SCOPe 2.03
  
• d4b95i_ appears in the current release, SCOPe 2.08