![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.3: Prealbumin-like [49451] (8 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
![]() | Superfamily b.3.3: VHL [49468] (1 family) ![]() automatically mapped to Pfam PF01847 |
![]() | Family b.3.3.1: VHL [49469] (2 proteins) |
![]() | Protein automated matches [193392] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [193393] (7 PDB entries) |
![]() | Domain d4b95i_: 4b95 I: [193439] Other proteins in same PDB: d4b95a_, d4b95b1, d4b95b2, d4b95c_, d4b95d_, d4b95e1, d4b95e2, d4b95f_, d4b95g_, d4b95h1, d4b95h2, d4b95j_, d4b95k1, d4b95k2, d4b95l_ automated match to d1lm8v_ complexed with act, uck |
PDB Entry: 4b95 (more details), 2.8 Å
SCOPe Domain Sequences for d4b95i_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4b95i_ b.3.3.1 (I:) automated matches {Human (Homo sapiens) [TaxId: 9606]} vlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfrd agthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrldiv rslyedledhpnvqkdlerltqer
Timeline for d4b95i_: