SCOPe 2.02: Domain d4b95j_: 4b95 J:

Lineage for d4b95j_ (4b95 J:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (9 families)

5. Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
   Pfam PF00240

6. Protein automated matches [190118] (8 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189560] (37 PDB entries)

8. Domain d4b95j_: 4b95 J: [193438]
   Other proteins in same PDB: d4b95h_, d4b95i_
   automated match to d1lm8b_
   complexed with act, uck

Details for d4b95j_

PDB Entry: 4b95

PDB Description: pvhl-elob-elob-eloc complex_(2s,4r)-1-(2-chlorophenyl)carbonyl-n-[(4- chlorophenyl)methyl]-4-oxidanyl-pyrrolidine-2-carboxamide bound

PDB Compounds: (J:) Transcription elongation factor B polypeptide 2

SCOPe Domain Sequences for d4b95j_:

Sequence, based on SEQRES records:

>d4b95j_ d.15.1.1 (J:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
gftsqtarpqapatvglafraddtfealciepfssppelpdvm

Sequence, based on observed residues (ATOM records):

>d4b95j_ d.15.1.1 (J:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
gftsqtarpqapatvglafradtfealciepfssppelpdvm

Timeline for d4b95j_:

• d4b95j_ is new in SCOPe 2.02-stable
  
• d4b95j_ appears in SCOPe 2.03
  
• d4b95j_ appears in the current release, SCOPe 2.08