Lineage for d4b95j_ (4b95 J:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1194674Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1194675Superfamily d.15.1: Ubiquitin-like [54236] (9 families) (S)
  5. 1194676Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 1195091Protein automated matches [190118] (8 species)
    not a true protein
  7. 1195101Species Human (Homo sapiens) [TaxId:9606] [189560] (37 PDB entries)
  8. 1195166Domain d4b95j_: 4b95 J: [193438]
    Other proteins in same PDB: d4b95h_, d4b95i_
    automated match to d1lm8b_
    complexed with act, uck

Details for d4b95j_

PDB Entry: 4b95 (more details)

PDB Description: pvhl-elob-elob-eloc complex_(2s,4r)-1-(2-chlorophenyl)carbonyl-n-[(4- chlorophenyl)methyl]-4-oxidanyl-pyrrolidine-2-carboxamide bound
PDB Compounds: (J:) Transcription elongation factor B polypeptide 2

SCOPe Domain Sequences for d4b95j_:

Sequence, based on SEQRES records: (download)

>d4b95j_ d.15.1.1 (J:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
gftsqtarpqapatvglafraddtfealciepfssppelpdvm

Sequence, based on observed residues (ATOM records): (download)

>d4b95j_ d.15.1.1 (J:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
gftsqtarpqapatvglafradtfealciepfssppelpdvm

SCOPe Domain Coordinates for d4b95j_:

Click to download the PDB-style file with coordinates for d4b95j_.
(The format of our PDB-style files is described here.)

Timeline for d4b95j_: