Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) |
Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
Protein automated matches [190118] (16 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189560] (113 PDB entries) |
Domain d4b95j_: 4b95 J: [193438] Other proteins in same PDB: d4b95a_, d4b95b1, d4b95b2, d4b95c_, d4b95d_, d4b95e1, d4b95e2, d4b95f_, d4b95g_, d4b95h1, d4b95h2, d4b95i_, d4b95k1, d4b95k2, d4b95l_ automated match to d1lm8b_ complexed with act, uck |
PDB Entry: 4b95 (more details), 2.8 Å
SCOPe Domain Sequences for d4b95j_:
Sequence, based on SEQRES records: (download)
>d4b95j_ d.15.1.1 (J:) automated matches {Human (Homo sapiens) [TaxId: 9606]} mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec gftsqtarpqapatvglafraddtfealciepfssppelpdvm
>d4b95j_ d.15.1.1 (J:) automated matches {Human (Homo sapiens) [TaxId: 9606]} mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec gftsqtarpqapatvglafradtfealciepfssppelpdvm
Timeline for d4b95j_: