SCOPe 2.06: Domain d4g2ea1: 4g2e A:1-155

Lineage for d4g2ea1 (4g2e A:1-155)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (165 species)
   not a true protein

7. Species Sulfolobus tokodaii [TaxId:273063] [193434] (2 PDB entries)

8. Domain d4g2ea1: 4g2e A:1-155 [193435]
   Other proteins in same PDB: d4g2ea2
   automated match to d3hjpa_

Details for d4g2ea1

PDB Entry: 4g2e, 1.4 Å

PDB Description: Crystal structure of a dimeric PrxQ from Sulfolobus tokodaii

PDB Compounds: (A:) peroxiredoxin

SCOPe Domain Sequences for d4g2ea1:

Sequence, based on SEQRES records:

>d4g2ea1 c.47.1.0 (A:1-155) automated matches {Sulfolobus tokodaii [TaxId: 273063]}
mveigelapdfelpdtelkkvklsalkgkvvvlafypaaftqvctkemctfrdsmakfnq
vnavvlgisvdppfsnkafkehnklnftilsdynrevvkkynvawefpalpgyvlakrav
fvidkegkvrykwvsddptkeppydeiekvvksls

Sequence, based on observed residues (ATOM records):

>d4g2ea1 c.47.1.0 (A:1-155) automated matches {Sulfolobus tokodaii [TaxId: 273063]}
mveigelapdfelpdtelkkvklsalkgkvvvlafypaaftqvtfrdsmakfnqvnavvl
gisvdppfsnkafkehnklnftilsdynrevvkkynvawefpalpgyvlakravfvidke
gkvrykwvsddptkeppydeiekvvksls

Timeline for d4g2ea1:

• d4g2ea1 first appeared in SCOPe 2.02, called d4g2ea_
  
• d4g2ea1 was called d4g2ea_ in SCOPe 2.05
  
• d4g2ea1 appears in SCOPe 2.07
  
• d4g2ea1 appears in the current release, SCOPe 2.08