Lineage for d4g2ea1 (4g2e A:1-155)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2880373Species Sulfolobus tokodaii [TaxId:273063] [193434] (2 PDB entries)
  8. 2880374Domain d4g2ea1: 4g2e A:1-155 [193435]
    Other proteins in same PDB: d4g2ea2
    automated match to d3hjpa_

Details for d4g2ea1

PDB Entry: 4g2e (more details), 1.4 Å

PDB Description: Crystal structure of a dimeric PrxQ from Sulfolobus tokodaii
PDB Compounds: (A:) peroxiredoxin

SCOPe Domain Sequences for d4g2ea1:

Sequence, based on SEQRES records: (download)

>d4g2ea1 c.47.1.0 (A:1-155) automated matches {Sulfolobus tokodaii [TaxId: 273063]}
mveigelapdfelpdtelkkvklsalkgkvvvlafypaaftqvctkemctfrdsmakfnq
vnavvlgisvdppfsnkafkehnklnftilsdynrevvkkynvawefpalpgyvlakrav
fvidkegkvrykwvsddptkeppydeiekvvksls

Sequence, based on observed residues (ATOM records): (download)

>d4g2ea1 c.47.1.0 (A:1-155) automated matches {Sulfolobus tokodaii [TaxId: 273063]}
mveigelapdfelpdtelkkvklsalkgkvvvlafypaaftqvtfrdsmakfnqvnavvl
gisvdppfsnkafkehnklnftilsdynrevvkkynvawefpalpgyvlakravfvidke
gkvrykwvsddptkeppydeiekvvksls

SCOPe Domain Coordinates for d4g2ea1:

Click to download the PDB-style file with coordinates for d4g2ea1.
(The format of our PDB-style files is described here.)

Timeline for d4g2ea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4g2ea2