SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d4gqcd1 (4gqc D:5-163)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2116932Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2116933Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2118053Family c.47.1.10: Glutathione peroxidase-like [52901] (29 protein domains)
  6. 2118138Protein Bacterioferritin comigratory protein [142377] (1 species)
  7. 2118139Species Aeropyrum pernix [TaxId:56636] [142378] (4 PDB entries)
    Uniprot Q9YA14 4-163
  8. 2118143Domain d4gqcd1: 4gqc D:5-163 [193433]
    Other proteins in same PDB: d4gqca2, d4gqcb2, d4gqcc2, d4gqcd2
    automated match to d2cx4a_
    complexed with dtd, gol, so4

Details for d4gqcd1

PDB Entry: 4gqc (more details), 2 Å

PDB Description: Crystal Structure of Aeropyrum pernix Peroxiredoxin Q Enzyme in Fully-Folded and Locally-Unfolded Conformations
PDB Compounds: (D:) Thiol Peroxidase

SCOPe Domain Sequences for d4gqcd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gqcd1 c.47.1.10 (D:5-163) Bacterioferritin comigratory protein {Aeropyrum pernix [TaxId: 56636]}
velgekapdftlpnqdfepvnlyevlkrgrpavliffpaafspvctkelctfrdkmaqle
kanaevlaisvdspwclkkfkdenrlafnllsdynreviklynvyhedlkglkmvakrav
fivkpdgtvaykwvtdnplnepdydevvreankiagelv

SCOPe Domain Coordinates for d4gqcd1:

Click to download the PDB-style file with coordinates for d4gqcd1.
(The format of our PDB-style files is described here.)

Timeline for d4gqcd1: