Lineage for d4gqfa_ (4gqf A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1168056Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1168057Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1169030Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)
  6. 1169100Protein Bacterioferritin comigratory protein [142377] (1 species)
  7. 1169101Species Aeropyrum pernix [TaxId:56636] [142378] (4 PDB entries)
    Uniprot Q9YA14 4-163
  8. 1169103Domain d4gqfa_: 4gqf A: [193432]
    automated match to d2cx4a_
    complexed with gol, so4

Details for d4gqfa_

PDB Entry: 4gqf (more details), 2.3 Å

PDB Description: Aeropyrum pernix Peroxiredoxin Q Enzyme in the Locally Unfolded Conformation
PDB Compounds: (A:) Thiol Peroxidase

SCOPe Domain Sequences for d4gqfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gqfa_ c.47.1.10 (A:) Bacterioferritin comigratory protein {Aeropyrum pernix [TaxId: 56636]}
kglvelgekapdftlpnqdfepvnlyevlkrgrpavliffpaafspvctkelctfrdkma
qlekanaevlaisvdspwclkkfkdenrlafnllsdynreviklynvyhedlkglkmvak
ravfivkpdgtvaykwvtdnplnepdydevvreankiagelva

SCOPe Domain Coordinates for d4gqfa_:

Click to download the PDB-style file with coordinates for d4gqfa_.
(The format of our PDB-style files is described here.)

Timeline for d4gqfa_: