SCOPe 2.08: Domain d4gqfa1: 4gqf A:5-164

Lineage for d4gqfa1 (4gqf A:5-164)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)

6. Protein Bacterioferritin comigratory protein [142377] (1 species)

7. Species Aeropyrum pernix [TaxId:56636] [142378] (4 PDB entries)
   Uniprot Q9YA14 4-163

8. Domain d4gqfa1: 4gqf A:5-164 [193432]
   Other proteins in same PDB: d4gqfa2, d4gqfb2
   automated match to d2cx4a_
   complexed with gol, so4

Details for d4gqfa1

PDB Entry: 4gqf, 2.3 Å

PDB Description: Aeropyrum pernix Peroxiredoxin Q Enzyme in the Locally Unfolded Conformation

PDB Compounds: (A:) Thiol Peroxidase

SCOPe Domain Sequences for d4gqfa1:

Sequence; same for both SEQRES and ATOM records:

>d4gqfa1 c.47.1.10 (A:5-164) Bacterioferritin comigratory protein {Aeropyrum pernix [TaxId: 56636]}
velgekapdftlpnqdfepvnlyevlkrgrpavliffpaafspvctkelctfrdkmaqle
kanaevlaisvdspwclkkfkdenrlafnllsdynreviklynvyhedlkglkmvakrav
fivkpdgtvaykwvtdnplnepdydevvreankiagelva

Timeline for d4gqfa1:

• d4gqfa1 first appeared in SCOPe 2.02, called d4gqfa_
  
• d4gqfa1 appears in SCOPe 2.07