| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins) |
| Protein Bacterioferritin comigratory protein [142377] (1 species) |
| Species Aeropyrum pernix [TaxId:56636] [142378] (4 PDB entries) Uniprot Q9YA14 4-163 |
| Domain d4gqfa1: 4gqf A:5-164 [193432] Other proteins in same PDB: d4gqfa2, d4gqfb2 automated match to d2cx4a_ complexed with gol, so4 |
PDB Entry: 4gqf (more details), 2.3 Å
SCOPe Domain Sequences for d4gqfa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4gqfa1 c.47.1.10 (A:5-164) Bacterioferritin comigratory protein {Aeropyrum pernix [TaxId: 56636]}
velgekapdftlpnqdfepvnlyevlkrgrpavliffpaafspvctkelctfrdkmaqle
kanaevlaisvdspwclkkfkdenrlafnllsdynreviklynvyhedlkglkmvakrav
fivkpdgtvaykwvtdnplnepdydevvreankiagelva
Timeline for d4gqfa1: