SCOPe 2.08: Domain d1qm6a1: 1qm6 A:1-249

Lineage for d1qm6a1 (1qm6 A:1-249)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.124: Phospholipase C/P1 nuclease [48536] (1 superfamily)
   multihelical

4. Superfamily a.124.1: Phospholipase C/P1 nuclease [48537] (3 families)
   duplication: all chain but the N-terminal helix forms two structural repeats

5. Family a.124.1.1: Phospholipase C [48538] (3 proteins)

6. Protein Alpha-toxin, N-terminal domain [48541] (2 species)

7. Species Clostridium perfringens, different strains [TaxId:1502] [48542] (6 PDB entries)

8. Domain d1qm6a1: 1qm6 A:1-249 [19343]
   Other proteins in same PDB: d1qm6a2, d1qm6b2
   complexed with zn

Details for d1qm6a1

PDB Entry: 1qm6, 2.5 Å

PDB Description: closed form of clostridium perfringens alpha-toxin strain nctc8237

PDB Compounds: (A:) phospholipase c

SCOPe Domain Sequences for d1qm6a1:

Sequence; same for both SEQRES and ATOM records:

>d1qm6a1 a.124.1.1 (A:1-249) Alpha-toxin, N-terminal domain {Clostridium perfringens, different strains [TaxId: 1502]}
wdgkidgtgthamivtqgvsilendlsknepesvrknleilkenmhelqlgstypdydkn
aydlyqdhfwdpdtdnnfskdnswylaysipdtgesqirkfsalaryewqrgnykqatfy
lgeamhyfgdidtpyhpanvtavdsaghvkfetfaeerkeqykintagcktneafytdil
knkdfnawskeyargfaktgksiyyshasmshswddwdyaakvtlansqkgtagyiyrfl
hdvsegndp

Timeline for d1qm6a1:

• d1qm6a1 first appeared (with stable ids) in SCOP 1.55
  
• d1qm6a1 appears in SCOPe 2.07