Lineage for d4asyc_ (4asy C:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2149496Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2149497Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2149676Family c.68.1.6: glucose-1-phosphate thymidylyltransferase [53464] (4 proteins)
    automatically mapped to Pfam PF00483
  6. 2149695Protein RmlA (RfbA) [53465] (5 species)
  7. 2149731Species Pseudomonas aeruginosa [TaxId:287] [53466] (9 PDB entries)
  8. 2149766Domain d4asyc_: 4asy C: [193421]
    automated match to d1fxob_
    complexed with cl, mes, n5y

Details for d4asyc_

PDB Entry: 4asy (more details), 2.3 Å

PDB Description: pseudomonas aeruginosa rmla in complex with allosteric inhibitor
PDB Compounds: (C:) glucose-1-phosphate thymidylyltransferase

SCOPe Domain Sequences for d4asyc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4asyc_ c.68.1.6 (C:) RmlA (RfbA) {Pseudomonas aeruginosa [TaxId: 287]}
mkrkgiilaggsgtrlhpatlaiskqllpvydkpmiyyplstlmlagireiliistpqdt
prfqqllgdgsnwgldlqyavqpspdglaqafligesfigndlsalvlgdnlyyghdfhe
llgsasqrqtgasvfayhvldperygvvefdqggkaisleekplepksnyavtglyfydq
qvvdiardlkpsprgeleitdvnraylergqlsveimgrgyawldtgthdslleagqfia
tlenrqglkvacpeeiayrqkwidaaqleklaaplakngygqylkrlltetvy

SCOPe Domain Coordinates for d4asyc_:

Click to download the PDB-style file with coordinates for d4asyc_.
(The format of our PDB-style files is described here.)

Timeline for d4asyc_: