Lineage for d4h3lb_ (4h3l B:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2164731Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2164732Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2164733Family d.22.1.1: Fluorescent proteins [54512] (6 protein domains)
  6. 2165015Protein automated matches [190406] (19 species)
    not a true protein
  7. 2165162Species Discosoma sp. [TaxId:301246] [188540] (5 PDB entries)
  8. 2165164Domain d4h3lb_: 4h3l B: [193411]
    automated match to d2qlgb_
    complexed with na

Details for d4h3lb_

PDB Entry: 4h3l (more details), 1.65 Å

PDB Description: mplum-e16p
PDB Compounds: (B:) Fluorescent protein plum

SCOPe Domain Sequences for d4h3lb_:

Sequence, based on SEQRES records: (download)

>d4h3lb_ d.22.1.1 (B:) automated matches {Discosoma sp. [TaxId: 301246]}
evikefmrfkphmegsvnghefeiegegegrpyegtqtarlkvtkggplpfawdilspqi
mygskayvkhpadipdylklsfpegfkwervmnfedggvvtvtqdsslqdgefiykvkvr
gtnfpsdgpvmqkktmgweassermypedgalkgemkmrlrlkdgghydaevkttymakk
pvqlpgayktdiklditshnedytiveqyeraegrhs

Sequence, based on observed residues (ATOM records): (download)

>d4h3lb_ d.22.1.1 (B:) automated matches {Discosoma sp. [TaxId: 301246]}
evikefmrfkphmegsvnghefeiegegegrpyegtqtarlkvtkggplpfawdilspqi
mygskayvkhpadipdylklsfpegfkwervmnfedggvvtvtqdsslqdgefiykvkvr
gtnfpsdgpvmqkktmgweassermypedgalkgemkmrlrlkgghydaevkttymakkp
vqlpgayktdiklditshnedytiveqyeraegrhs

SCOPe Domain Coordinates for d4h3lb_:

Click to download the PDB-style file with coordinates for d4h3lb_.
(The format of our PDB-style files is described here.)

Timeline for d4h3lb_: