![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
![]() | Superfamily d.22.1: GFP-like [54511] (3 families) ![]() |
![]() | Family d.22.1.1: Fluorescent proteins [54512] (6 proteins) |
![]() | Protein automated matches [190406] (19 species) not a true protein |
![]() | Species Discosoma sp. [TaxId:301246] [188540] (5 PDB entries) |
![]() | Domain d4h3lb_: 4h3l B: [193411] automated match to d2qlgb_ complexed with na |
PDB Entry: 4h3l (more details), 1.65 Å
SCOPe Domain Sequences for d4h3lb_:
Sequence, based on SEQRES records: (download)
>d4h3lb_ d.22.1.1 (B:) automated matches {Discosoma sp. [TaxId: 301246]} evikefmrfkphmegsvnghefeiegegegrpyegtqtarlkvtkggplpfawdilspqi mygskayvkhpadipdylklsfpegfkwervmnfedggvvtvtqdsslqdgefiykvkvr gtnfpsdgpvmqkktmgweassermypedgalkgemkmrlrlkdgghydaevkttymakk pvqlpgayktdiklditshnedytiveqyeraegrhs
>d4h3lb_ d.22.1.1 (B:) automated matches {Discosoma sp. [TaxId: 301246]} evikefmrfkphmegsvnghefeiegegegrpyegtqtarlkvtkggplpfawdilspqi mygskayvkhpadipdylklsfpegfkwervmnfedggvvtvtqdsslqdgefiykvkvr gtnfpsdgpvmqkktmgweassermypedgalkgemkmrlrlkgghydaevkttymakkp vqlpgayktdiklditshnedytiveqyeraegrhs
Timeline for d4h3lb_: