Lineage for d4hhht_ (4hhh T:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1913207Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
    alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta
  4. 1913208Superfamily d.73.1: RuBisCO, small subunit [55239] (1 family) (S)
  5. 1913209Family d.73.1.1: RuBisCO, small subunit [55240] (2 proteins)
  6. 1913367Protein automated matches [190066] (5 species)
    not a true protein
  7. 1913436Species Pea (Pisum sativum) [TaxId:3888] [193409] (2 PDB entries)
  8. 1913442Domain d4hhht_: 4hhh T: [193410]
    Other proteins in same PDB: d4hhha1, d4hhha2, d4hhhb1, d4hhhb2, d4hhhc1, d4hhhc2, d4hhhd1, d4hhhd2
    automated match to d3rubs_
    complexed with rub

Details for d4hhht_

PDB Entry: 4hhh (more details), 2.2 Å

PDB Description: Structure of Pisum sativum Rubisco
PDB Compounds: (T:) ribulose bisphosphate carboxylase small chain

SCOPe Domain Sequences for d4hhht_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hhht_ d.73.1.1 (T:) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
mqvwppigkkkfetlsylppltrdqllkeveyllrkgwvpclefelkkgfvyrehnkspg
yydgrywtmwklpmfgttdpaqvlkeldevkkeyprafvrvigfnnvrqvqcisfiahtp
esy

SCOPe Domain Coordinates for d4hhht_:

Click to download the PDB-style file with coordinates for d4hhht_.
(The format of our PDB-style files is described here.)

Timeline for d4hhht_: