Lineage for d1qmda1 (1qmd A:1-249)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 6439Fold a.124: Phospholipase C/P1 nuclease [48536] (1 superfamily)
  4. 6440Superfamily a.124.1: Phospholipase C/P1 nuclease [48537] (2 families) (S)
  5. 6441Family a.124.1.1: Phospholipase C [48538] (2 proteins)
  6. 6442Protein Alpha-toxin, N-terminal domain [48541] (1 species)
  7. 6443Species Clostridium perfringens [TaxId:1502] [48542] (3 PDB entries)
  8. 6445Domain d1qmda1: 1qmd A:1-249 [19341]
    Other proteins in same PDB: d1qmda2, d1qmdb2

Details for d1qmda1

PDB Entry: 1qmd (more details), 2.2 Å

PDB Description: calcium bound closed form alpha-toxin from clostridium perfringens

SCOP Domain Sequences for d1qmda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qmda1 a.124.1.1 (A:1-249) Alpha-toxin, N-terminal domain {Clostridium perfringens}
wdgkidgtgthamivtqgvsilendlsknepesvrknleilkenmhelqlgstypdydkn
aydlyqdhfwdpdtdnnfskdnswylaysipdtgesqirkfsalaryewqrgnykqatfy
lgeamhyfgdidtpyhpanvtavdsaghvkfetfaeerkeqykintagcktneafytdil
knkdfnawskeyargfaktgksiyyshasmshswddwdyaakvtlansqkgtagyiyrfl
hdvsegndp

SCOP Domain Coordinates for d1qmda1:

Click to download the PDB-style file with coordinates for d1qmda1.
(The format of our PDB-style files is described here.)

Timeline for d1qmda1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qmda2