SCOPe 2.08: Domain d4hlca_: 4hlc A:

Lineage for d4hlca_ (4hlc A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (158 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:282458] [193407] (9 PDB entries)

8. Domain d4hlca_: 4hlc A: [193408]
   automated match to d2ccja_
   complexed with t05

Details for d4hlca_

PDB Entry: 4hlc, 1.55 Å

PDB Description: Sulfonylpiperidines as Novel, Antibacterial Inhibitors of Gram-Positive Thymidylate Kinase (TMK): Compound 5

PDB Compounds: (A:) thymidylate kinase

SCOPe Domain Sequences for d4hlca_:

Sequence, based on SEQRES records:

>d4hlca_ c.37.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 282458]}
safitfegpegsgkttvinevyhrlvkdydvimtrepggvptgeeirkivlegndmdirt
eamlfaasrrehlvlkvipalkegkvvlcdryidsslayqgyargigveevralnefain
glypdltiylnvsaevgreriiknsrdqnrldqedlkfhekviegyqeiihnesqrfksv
nadqplenvvedtyqtiikyle

Sequence, based on observed residues (ATOM records):

>d4hlca_ c.37.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 282458]}
safitfegpegsgkttvinevyhrlvkdydvimtrepggvptgeeirkivlegndmdirt
eamlfaasrrehlvlkvipalkegkvvlcdryidsslayqgyargigveevralnefain
glypdltiylnvsaevgreriikldqedlkfhekviegyqeiihnesqrfksvnadqple
nvvedtyqtiikyle

Timeline for d4hlca_:

• d4hlca_ first appeared in SCOPe 2.02
  
• d4hlca_ appears in SCOPe 2.07