Lineage for d4a78a_ (4a78 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2333057Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2333058Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2333059Family a.93.1.1: CCP-like [48114] (5 proteins)
  6. 2333414Protein automated matches [190089] (9 species)
    not a true protein
  7. 2333415Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [188305] (24 PDB entries)
  8. 2333436Domain d4a78a_: 4a78 A: [193406]
    automated match to d1s73a_
    complexed with hem, jz3

Details for d4a78a_

PDB Entry: 4a78 (more details), 2.01 Å

PDB Description: cytochrome c peroxidase m119w in complex with guiacol
PDB Compounds: (A:) Cytochrome c peroxidase, mitochondrial

SCOPe Domain Sequences for d4a78a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4a78a_ a.93.1.1 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tplvhvasvekgrsyedfqkvynaialklreddeydnaigygpvlvrlawhtsgtwdkhd
ntggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqewqg
pkipwrcgrvdtpedttpdngrlpdadkdadyvrtffqrlnmndrevvalmgahalgkth
lknsgyegpwgaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliqd
pkylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl

SCOPe Domain Coordinates for d4a78a_:

Click to download the PDB-style file with coordinates for d4a78a_.
(The format of our PDB-style files is described here.)

Timeline for d4a78a_: