SCOPe 2.02: Domain d4a78a_: 4a78 A:

Lineage for d4a78a_ (4a78 A:)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families)

5. Family a.93.1.1: CCP-like [48114] (5 proteins)

6. Protein automated matches [190089] (7 species)
   not a true protein

7. Species Saccharomyces cerevisiae [TaxId:4932] [192500] (2 PDB entries)

8. Domain d4a78a_: 4a78 A: [193406]
   automated match to d1s73a_
   complexed with hem, jz3

Details for d4a78a_

PDB Entry: 4a78, 2.01 Å

PDB Description: cytochrome c peroxidase m119w in complex with guiacol

PDB Compounds: (A:) Cytochrome c peroxidase, mitochondrial

SCOPe Domain Sequences for d4a78a_:

Sequence; same for both SEQRES and ATOM records:

>d4a78a_ a.93.1.1 (A:) automated matches {Saccharomyces cerevisiae [TaxId: 4932]}
tplvhvasvekgrsyedfqkvynaialklreddeydnaigygpvlvrlawhtsgtwdkhd
ntggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqewqg
pkipwrcgrvdtpedttpdngrlpdadkdadyvrtffqrlnmndrevvalmgahalgkth
lknsgyegpwgaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliqd
pkylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl

Timeline for d4a78a_:

• d4a78a_ is new in SCOPe 2.02-stable
  
• d4a78a_ appears in SCOPe 2.03
  
• d4a78a_ appears in the current release, SCOPe 2.08