Class b: All beta proteins [48724] (174 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins) |
Protein automated matches [190044] (14 species) not a true protein |
Species Pig (Sus scrofa) [TaxId:9823] [193403] (1 PDB entry) |
Domain d4an7a_: 4an7 A: [193404] automated match to d1s83a_ complexed with ca |
PDB Entry: 4an7 (more details), 2.23 Å
SCOPe Domain Sequences for d4an7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4an7a_ b.47.1.2 (A:) automated matches {Pig (Sus scrofa) [TaxId: 9823]} ivggytcaansipyqvslnsgshfcggslinsqwvvsaahcyksriqvrlgehnidvleg neqfinaakiithpnfngntldndimliklsspatlnsrvatvslprscaaagteclisg wgntkssgssypsllqclkapvlsdssckssypgqitgnmicvgfleggkdscqgdsggp vvcngqlqgivswgygcaqknkpgvytkvcnyvnwiqqtiaan
Timeline for d4an7a_: