| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
| Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
| Protein automated matches [190359] (44 species) not a true protein |
| Species Eleginops maclovinus [TaxId:56733] [193401] (2 PDB entries) |
| Domain d4esad_: 4esa D: [193402] automated match to d2h8fb_ complexed with cmo, gol, hem |
PDB Entry: 4esa (more details), 1.45 Å
SCOPe Domain Sequences for d4esad_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4esad_ a.1.1.2 (D:) automated matches {Eleginops maclovinus [TaxId: 56733]}
vewtdqeratissifgsldyddigpkalsrclivypwtqrhfgsfgnlynaeaiignqkv
aahgikvlhgldravknmdnikeiyaelsilhseklhvdpdnfklladcltivvaakmgs
gfnpgtqatfqkflavvvsalgkqy
Timeline for d4esad_: