Lineage for d1ca1_1 (1ca1 1-249)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.124: Phospholipase C/P1 nuclease [48536] (1 superfamily) Superfamily a.124.1: Phospholipase C/P1 nuclease [48537] (2 families) 
Family a.124.1.1: Phospholipase C [48538] (2 proteins) 
Protein Alpha-toxin, N-terminal domain [48541] (1 species) Species Clostridium perfringens [TaxId:1502] [48542] (3 PDB entries) 
Domain d1ca1_1: 1ca1 1-249 [19340]
Other proteins in same PDB: d1ca1_2
Details for d1ca1_1
PDB Entry: 1ca1 (more details), 1.9 Å
PDB Description: alpha-toxin from clostridium perfringens
SCOP Domain Sequences for d1ca1_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ca1_1 a.124.1.1 (1-249) Alpha-toxin, N-terminal domain {Clostridium perfringens}
wdgkidgtgthamivtqgvsilendlsknepesvrknleilkenmhelqlgstypdydkn
aydlyqdhfwdpdtdnnfskdnswylaysipdtgesqirkfsalaryewqrgnykqatfy
lgeamhyfgdidtpyhpanvtavdsaghvkfetfaeerkeqykintvgcktnedfyadil
knkdfnawskeyargfaktgksiyyshasmshswddwdyaakvtlansqkgtagyiyrfl
hdvsegndp
SCOP Domain Coordinates for d1ca1_1:
Click to download the PDB-style file with coordinates for d1ca1_1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ca1_1:
- d1ca1_1 appears in SCOP 1.57
- d1ca1_1 appears in the current release, SCOPe 2.08, called d1ca1a1
View in 3D
