Lineage for d1ca1_1 (1ca1 1-249)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 6439Fold a.124: Phospholipase C/P1 nuclease [48536] (1 superfamily)
  4. 6440Superfamily a.124.1: Phospholipase C/P1 nuclease [48537] (2 families) (S)
  5. 6441Family a.124.1.1: Phospholipase C [48538] (2 proteins)
  6. 6442Protein Alpha-toxin, N-terminal domain [48541] (1 species)
  7. 6443Species Clostridium perfringens [TaxId:1502] [48542] (3 PDB entries)
  8. 6444Domain d1ca1_1: 1ca1 1-249 [19340]
    Other proteins in same PDB: d1ca1_2

Details for d1ca1_1

PDB Entry: 1ca1 (more details), 1.9 Å

PDB Description: alpha-toxin from clostridium perfringens

SCOP Domain Sequences for d1ca1_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ca1_1 a.124.1.1 (1-249) Alpha-toxin, N-terminal domain {Clostridium perfringens}
wdgkidgtgthamivtqgvsilendlsknepesvrknleilkenmhelqlgstypdydkn
aydlyqdhfwdpdtdnnfskdnswylaysipdtgesqirkfsalaryewqrgnykqatfy
lgeamhyfgdidtpyhpanvtavdsaghvkfetfaeerkeqykintvgcktnedfyadil
knkdfnawskeyargfaktgksiyyshasmshswddwdyaakvtlansqkgtagyiyrfl
hdvsegndp

SCOP Domain Coordinates for d1ca1_1:

Click to download the PDB-style file with coordinates for d1ca1_1.
(The format of our PDB-style files is described here.)

Timeline for d1ca1_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ca1_2