![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.124: Phospholipase C/P1 nuclease [48536] (1 superfamily) multihelical |
![]() | Superfamily a.124.1: Phospholipase C/P1 nuclease [48537] (3 families) ![]() duplication: all chain but the N-terminal helix forms two structural repeats |
![]() | Family a.124.1.1: Phospholipase C [48538] (3 proteins) |
![]() | Protein Alpha-toxin, N-terminal domain [48541] (2 species) |
![]() | Species Clostridium perfringens, different strains [TaxId:1502] [48542] (6 PDB entries) |
![]() | Domain d1ca1a1: 1ca1 A:1-249 [19340] Other proteins in same PDB: d1ca1a2 complexed with cd, zn |
PDB Entry: 1ca1 (more details), 1.9 Å
SCOPe Domain Sequences for d1ca1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ca1a1 a.124.1.1 (A:1-249) Alpha-toxin, N-terminal domain {Clostridium perfringens, different strains [TaxId: 1502]} wdgkidgtgthamivtqgvsilendlsknepesvrknleilkenmhelqlgstypdydkn aydlyqdhfwdpdtdnnfskdnswylaysipdtgesqirkfsalaryewqrgnykqatfy lgeamhyfgdidtpyhpanvtavdsaghvkfetfaeerkeqykintvgcktnedfyadil knkdfnawskeyargfaktgksiyyshasmshswddwdyaakvtlansqkgtagyiyrfl hdvsegndp
Timeline for d1ca1a1: