Lineage for d1ca1a1 (1ca1 A:1-249)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2730190Fold a.124: Phospholipase C/P1 nuclease [48536] (1 superfamily)
    multihelical
  4. 2730191Superfamily a.124.1: Phospholipase C/P1 nuclease [48537] (3 families) (S)
    duplication: all chain but the N-terminal helix forms two structural repeats
  5. 2730192Family a.124.1.1: Phospholipase C [48538] (3 proteins)
  6. 2730193Protein Alpha-toxin, N-terminal domain [48541] (2 species)
  7. 2730199Species Clostridium perfringens, different strains [TaxId:1502] [48542] (6 PDB entries)
  8. 2730200Domain d1ca1a1: 1ca1 A:1-249 [19340]
    Other proteins in same PDB: d1ca1a2
    complexed with cd, zn

Details for d1ca1a1

PDB Entry: 1ca1 (more details), 1.9 Å

PDB Description: alpha-toxin from clostridium perfringens
PDB Compounds: (A:) alpha-toxin

SCOPe Domain Sequences for d1ca1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ca1a1 a.124.1.1 (A:1-249) Alpha-toxin, N-terminal domain {Clostridium perfringens, different strains [TaxId: 1502]}
wdgkidgtgthamivtqgvsilendlsknepesvrknleilkenmhelqlgstypdydkn
aydlyqdhfwdpdtdnnfskdnswylaysipdtgesqirkfsalaryewqrgnykqatfy
lgeamhyfgdidtpyhpanvtavdsaghvkfetfaeerkeqykintvgcktnedfyadil
knkdfnawskeyargfaktgksiyyshasmshswddwdyaakvtlansqkgtagyiyrfl
hdvsegndp

SCOPe Domain Coordinates for d1ca1a1:

Click to download the PDB-style file with coordinates for d1ca1a1.
(The format of our PDB-style files is described here.)

Timeline for d1ca1a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ca1a2