Lineage for d4awjf_ (4awj F:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1113318Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 1113468Superfamily b.3.3: VHL [49468] (1 family) (S)
  5. 1113469Family b.3.3.1: VHL [49469] (2 proteins)
  6. 1113478Protein automated matches [193392] (1 species)
    not a true protein
  7. 1113479Species Homo sapiens [TaxId:9606] [193393] (3 PDB entries)
  8. 1113481Domain d4awjf_: 4awj F: [193394]
    Other proteins in same PDB: d4awjd_, d4awjg_
    automated match to d1lm8v_
    complexed with act, acy, gol, v6f

Details for d4awjf_

PDB Entry: 4awj (more details), 2.5 Å

PDB Description: pVHL:EloB:EloC complex, in complex with capped Hydroxyproline
PDB Compounds: (F:) von hippel-lindau disease tumor suppressor

SCOPe Domain Sequences for d4awjf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4awjf_ b.3.3.1 (F:) automated matches {Homo sapiens [TaxId: 9606]}
lrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfrda
gthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrldivr
slyedledhpnvqkdlerltqe

SCOPe Domain Coordinates for d4awjf_:

Click to download the PDB-style file with coordinates for d4awjf_.
(The format of our PDB-style files is described here.)

Timeline for d4awjf_: