Lineage for d1ah7a_ (1ah7 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2343242Fold a.124: Phospholipase C/P1 nuclease [48536] (1 superfamily)
    multihelical
  4. 2343243Superfamily a.124.1: Phospholipase C/P1 nuclease [48537] (3 families) (S)
    duplication: all chain but the N-terminal helix forms two structural repeats
  5. 2343244Family a.124.1.1: Phospholipase C [48538] (3 proteins)
  6. 2343262Protein Bacterial phosholipase C [48539] (1 species)
  7. 2343263Species Bacillus cereus [TaxId:1396] [48540] (7 PDB entries)
  8. 2343266Domain d1ah7a_: 1ah7 A: [19339]
    complexed with zn

Details for d1ah7a_

PDB Entry: 1ah7 (more details), 1.5 Å

PDB Description: phospholipase c from bacillus cereus
PDB Compounds: (A:) phospholipase c

SCOPe Domain Sequences for d1ah7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ah7a_ a.124.1.1 (A:) Bacterial phosholipase C {Bacillus cereus [TaxId: 1396]}
wsaedkhkegvnshlwivnraidimsrnttlvkqdrvaqlnewrtelengiyaadyenpy
ydnstfashfydpdngktyipfakqaketgakyfklagesyknkdmkqaffylglslhyl
gdvnqpmhaanftnlsypqgfhskyenfvdtikdnykvtdgngywnwkgtnpeewihgaa
vvakqdysgivndntkdwfvkaavsqeyadkwraevtpmtgkrlmdaqrvtagyiqlwfd
tygdr

SCOPe Domain Coordinates for d1ah7a_:

Click to download the PDB-style file with coordinates for d1ah7a_.
(The format of our PDB-style files is described here.)

Timeline for d1ah7a_: