![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily) beta-alpha-beta(3); 2 layers: alpha/beta |
![]() | Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) ![]() |
![]() | Family d.32.1.0: automated matches [191344] (1 protein) not a true family |
![]() | Protein automated matches [190239] (26 species) not a true protein |
![]() | Species Clostridium acetobutylicum [TaxId:1488] [193388] (2 PDB entries) |
![]() | Domain d2qh0a1: 2qh0 A:4-130 [193389] Other proteins in same PDB: d2qh0a2 automated match to d3rmua_ complexed with zn |
PDB Entry: 2qh0 (more details), 2.45 Å
SCOPe Domain Sequences for d2qh0a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qh0a1 d.32.1.0 (A:4-130) automated matches {Clostridium acetobutylicum [TaxId: 1488]} kvhhigyavknidsalkkfkrlgyveesevvrdevrkvyiqfvinggyrvelvapdgeds pinktikkgstpyhicyevediqksieemsqigytlfkkaeiapaidnrkvaflfstdig liellek
Timeline for d2qh0a1: