Lineage for d2qh0a1 (2qh0 A:4-130)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2549433Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 2549434Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) (S)
  5. 2549945Family d.32.1.0: automated matches [191344] (1 protein)
    not a true family
  6. 2549946Protein automated matches [190239] (26 species)
    not a true protein
  7. 2549980Species Clostridium acetobutylicum [TaxId:1488] [193388] (2 PDB entries)
  8. 2549982Domain d2qh0a1: 2qh0 A:4-130 [193389]
    Other proteins in same PDB: d2qh0a2
    automated match to d3rmua_
    complexed with zn

Details for d2qh0a1

PDB Entry: 2qh0 (more details), 2.45 Å

PDB Description: crystal structure of a glyoxalase from clostridium acetobutylicum
PDB Compounds: (A:) lactoylglutathione lyase

SCOPe Domain Sequences for d2qh0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qh0a1 d.32.1.0 (A:4-130) automated matches {Clostridium acetobutylicum [TaxId: 1488]}
kvhhigyavknidsalkkfkrlgyveesevvrdevrkvyiqfvinggyrvelvapdgeds
pinktikkgstpyhicyevediqksieemsqigytlfkkaeiapaidnrkvaflfstdig
liellek

SCOPe Domain Coordinates for d2qh0a1:

Click to download the PDB-style file with coordinates for d2qh0a1.
(The format of our PDB-style files is described here.)

Timeline for d2qh0a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2qh0a2