SCOPe 2.08: Domain d2qh0a1: 2qh0 A:4-130

Lineage for d2qh0a1 (2qh0 A:4-130)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families)

5. Family d.32.1.0: automated matches [191344] (1 protein)
   not a true family

6. Protein automated matches [190239] (26 species)
   not a true protein

7. Species Clostridium acetobutylicum [TaxId:1488] [193388] (2 PDB entries)

8. Domain d2qh0a1: 2qh0 A:4-130 [193389]
   Other proteins in same PDB: d2qh0a2
   automated match to d3rmua_
   complexed with zn

Details for d2qh0a1

PDB Entry: 2qh0, 2.45 Å

PDB Description: crystal structure of a glyoxalase from clostridium acetobutylicum

PDB Compounds: (A:) lactoylglutathione lyase

SCOPe Domain Sequences for d2qh0a1:

Sequence; same for both SEQRES and ATOM records:

>d2qh0a1 d.32.1.0 (A:4-130) automated matches {Clostridium acetobutylicum [TaxId: 1488]}
kvhhigyavknidsalkkfkrlgyveesevvrdevrkvyiqfvinggyrvelvapdgeds
pinktikkgstpyhicyevediqksieemsqigytlfkkaeiapaidnrkvaflfstdig
liellek

Timeline for d2qh0a1:

• d2qh0a1 first appeared in SCOPe 2.02, called d2qh0a_
  
• d2qh0a1 appears in SCOPe 2.07