![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.73: RuBisCO, small subunit [55238] (1 superfamily) alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta |
![]() | Superfamily d.73.1: RuBisCO, small subunit [55239] (2 families) ![]() |
![]() | Family d.73.1.1: RuBisCO, small subunit [55240] (2 proteins) |
![]() | Protein automated matches [190066] (7 species) not a true protein |
![]() | Species Red algae (Galdieria sulphuraria) [TaxId:130081] [193382] (3 PDB entries) |
![]() | Domain d4f0kb_: 4f0k B: [193383] Other proteins in same PDB: d4f0ka1, d4f0ka2 automated match to d1iwab_ complexed with cl, co2, gol, mg |
PDB Entry: 4f0k (more details), 2.05 Å
SCOPe Domain Sequences for d4f0kb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4f0kb_ d.73.1.1 (B:) automated matches {Red algae (Galdieria sulphuraria) [TaxId: 130081]} mritqgtfsflpdltdeqikkqidymiskklaigieytndihprnsfwemwglplfevtd papvlfeinacrkaksnfyikvvgfssergiestiisfivnrpkhepgfnlirqedksrs ikysiqayetykpedqry
Timeline for d4f0kb_: