Lineage for d4gqsb_ (4gqs B:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1094812Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 1094813Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 1094814Family a.104.1.1: Cytochrome P450 [48265] (23 proteins)
  6. 1095198Protein automated matches [190068] (8 species)
    not a true protein
  7. 1095211Species Human (Homo sapiens) [TaxId:9606] [189507] (5 PDB entries)
  8. 1095216Domain d4gqsb_: 4gqs B: [193379]
    automated match to d1r9oa_
    complexed with 0xv, gol, hem

Details for d4gqsb_

PDB Entry: 4gqs (more details), 2.87 Å

PDB Description: Structure of Human Microsomal Cytochrome P450 (CYP) 2C19
PDB Compounds: (B:) Cytochrome P450 2C19

SCOPe Domain Sequences for d4gqsb_:

Sequence, based on SEQRES records: (download)

>d4gqsb_ a.104.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lppgptplpvignilqidikdvsksltnlskiygpvftlyfglermvvlhgyevvkeali
dlgeefsgrghfplaeranrgfgivfsngkrwkeirrfslmtlrnfgmgkrsiedrvqee
arclveelrktkaspcdptfilgcapcnvicsiifqkrfdykdqqflnlmeklneniriv
stpwiqicnnfptiidyfpgthnkllknlafmesdilekvkehqesmdinnprdfidcfl
ikmekekqnqqseftienlvitaadllgagtettsttlryalllllkhpevtakvqeeie
rvvgrnrspcmqdrghmpytdavvhevqryidliptslphavtcdvkfrnylipkgttil
tsltsvlhdnkefpnpemfdprhfldeggnfkksnyfmpfsagkricvgeglarmelflf
ltfilqnfnlkslidpkdldttpvvngfasvppfyqlcfipi

Sequence, based on observed residues (ATOM records): (download)

>d4gqsb_ a.104.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lppgptplpvignilqidikdvsksltnlskiygpvftlyfglermvvlhgyevvkeali
dlgeefsgrghfplaeranrgfgivfsngkrwkeirrfslmtlrnfgmgkrsiedrvqee
arclveelrktkaspcdptfilgcapcnvicsiifqkrfdykdqqflnlmeklneniriv
stpwiqicnnyfpgthnkllknlafmesdilekvkehqesmdinnprdfidcflikmeke
kqnqqseftienlvitaadllgagtettsttlryalllllkhpevtakvqeeiervvgrn
rspcmqdrghmpytdavvhevqryidliptslphavtcdvkfrnylipkgttiltsltsv
lhdnkefpnpemfdprhfldeggnfkksnyfmpfsagkricvgeglarmelflfltfilq
nfnlkslidpkdldttpvvngfasvppfyqlcfipi

SCOPe Domain Coordinates for d4gqsb_:

Click to download the PDB-style file with coordinates for d4gqsb_.
(The format of our PDB-style files is described here.)

Timeline for d4gqsb_:

  • d4gqsb_ appears in periodic updates to SCOPe 2.02 starting on 2013-05-24
  • d4gqsb_ appears in SCOPe 2.03
  • d4gqsb_ appears in the current release, SCOPe 2.07, called d4gqsb1