Lineage for d2p4ra1 (2p4r A:10-63)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2782861Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2782862Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 2783254Protein automated matches [190043] (8 species)
    not a true protein
  7. 2783348Species Norway rat (Rattus norvegicus) [TaxId:10116] [187407] (7 PDB entries)
  8. 2783357Domain d2p4ra1: 2p4r A:10-63 [193377]
    Other proteins in same PDB: d2p4ra2
    automated match to d2ak5b_
    complexed with gol, so4

Details for d2p4ra1

PDB Entry: 2p4r (more details), 2 Å

PDB Description: Structural basis for a novel interaction between AIP4 and beta-PIX
PDB Compounds: (A:) Rho guanine nucleotide exchange factor 7

SCOPe Domain Sequences for d2p4ra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p4ra1 b.34.2.1 (A:10-63) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
vvrakfnfqqtnedelsfskgdvihvtrveeggwwegthngrtgwfpsnyvrei

SCOPe Domain Coordinates for d2p4ra1:

Click to download the PDB-style file with coordinates for d2p4ra1.
(The format of our PDB-style files is described here.)

Timeline for d2p4ra1: