SCOPe 2.08: Domain d2p4ra1: 2p4r A:10-63

Lineage for d2p4ra1 (2p4r A:10-63)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.1: SH3-domain [50045] (40 proteins)

6. Protein automated matches [190043] (8 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [187407] (7 PDB entries)

8. Domain d2p4ra1: 2p4r A:10-63 [193377]
   Other proteins in same PDB: d2p4ra2
   automated match to d2ak5b_
   complexed with gol, so4

Details for d2p4ra1

PDB Entry: 2p4r, 2 Å

PDB Description: Structural basis for a novel interaction between AIP4 and beta-PIX

PDB Compounds: (A:) Rho guanine nucleotide exchange factor 7

SCOPe Domain Sequences for d2p4ra1:

Sequence; same for both SEQRES and ATOM records:

>d2p4ra1 b.34.2.1 (A:10-63) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
vvrakfnfqqtnedelsfskgdvihvtrveeggwwegthngrtgwfpsnyvrei

Timeline for d2p4ra1:

• d2p4ra1 first appeared in SCOPe 2.02, called d2p4ra_
  
• d2p4ra1 appears in SCOPe 2.07