SCOPe 2.05: Domain d2q87b_: 2q87 B:

Lineage for d2q87b_ (2q87 B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (558 PDB entries)

8. Domain d2q87b_: 2q87 B: [193367]
   automated match to d2nmsa_

Details for d2q87b_

PDB Entry: 2q87, 1.7 Å

PDB Description: the crystal structure of the human irp60 ectodomain

PDB Compounds: (B:) CMRF35-H antigen

SCOPe Domain Sequences for d2q87b_:

Sequence; same for both SEQRES and ATOM records:

>d2q87b_ b.1.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvagpvggslsvqcpyekehrtlnkywcrppqiflcdkivetkgsagkrngrvsirdsp
anlsftvtlenlteedagtywcgvdtpwlqdfhdpvvevevsvfpas

Timeline for d2q87b_:

• d2q87b_ first appeared in SCOPe 2.02
  
• d2q87b_ appears in SCOPe 2.04
  
• d2q87b_ is called d2q87b1 in SCOPe 2.06
  
• d2q87b_ appears in the current release, SCOPe 2.08, called d2q87b1