Lineage for d1hg4c_ (1hg4 C:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2008478Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2009346Protein Ultraspiracle protein, usp [48534] (2 species)
    the ortholog of RXRs in insects
  7. 2009347Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [48535] (1 PDB entry)
  8. 2009350Domain d1hg4c_: 1hg4 C: [19335]
    complexed with lpp

Details for d1hg4c_

PDB Entry: 1hg4 (more details), 2.4 Å

PDB Description: Ultraspiracle ligand binding domain from Drosophila melanogaster
PDB Compounds: (C:) ultraspiracle

SCOPe Domain Sequences for d1hg4c_:

Sequence, based on SEQRES records: (download)

>d1hg4c_ a.123.1.1 (C:) Ultraspiracle protein, usp {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
fsieriieaeqraetqcgdraltflrvgpystvqpdykgavsalcqvvnkqlfqmveyar
mmphfaqvplddqvillkaawiellianvawcsivslddggagggggglghdgsferrsp
glqpqqlflnqsfsyhrnsaikagvsaifdrilselsvkmkrlnldrrelsclkaiilyn
pdirgiksraeiemcrekvyacldehcrlehpgddgrfaqlllrlpalrsislkcqdhlf
lfritsdrpleelfleqleappppg

Sequence, based on observed residues (ATOM records): (download)

>d1hg4c_ a.123.1.1 (C:) Ultraspiracle protein, usp {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
fsieriieaeqraetqcgdraltflrvgpystvqpdykgavsalcqvvnkqlfqmveyar
mmphfaqvplddqvillkaawiellianvawcsivslqqlflnqsfsyhrnsaikagvsa
ifdrilselsvkmkrlnldrrelsclkaiilynpdirgiksraeiemcrekvyacldehc
rlehpgddgrfaqlllrlpalrsislkcqdhlflfritsdrpleelfleqleappppg

SCOPe Domain Coordinates for d1hg4c_:

Click to download the PDB-style file with coordinates for d1hg4c_.
(The format of our PDB-style files is described here.)

Timeline for d1hg4c_: