SCOPe 2.06: Domain d4h6jb1: 4h6j B:357-466

Lineage for d4h6jb1 (4h6j B:357-466)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families)
   alpha-beta(2)-alpha(2)-beta(3)

5. Family d.110.3.0: automated matches [191387] (1 protein)
   not a true family

6. Protein automated matches [190492] (20 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187434] (22 PDB entries)

8. Domain d4h6jb1: 4h6j B:357-466 [193345]
   Other proteins in same PDB: d4h6ja_, d4h6jb2
   automated match to d3f1nb_

Details for d4h6jb1

PDB Entry: 4h6j, 1.52 Å

PDB Description: identification of cys 255 in hif-1 as a novel site for development of covalent inhibitors of hif-1 /arnt pasb domain protein-protein interaction.

PDB Compounds: (B:) aryl hydrocarbon nuclear translocator

SCOPe Domain Sequences for d4h6jb1:

Sequence; same for both SEQRES and ATOM records:

>d4h6jb1 d.110.3.0 (B:357-466) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vcqptrfisrhniegiftfvdhrcvatvgyqpqellgknivefchpedqqllrdsfqqvv
klkgqvlsvmfrfrsknqewlwmrtssftfqnpysdeieyiictntnvkn

Timeline for d4h6jb1:

• d4h6jb1 first appeared in SCOPe 2.02, called d4h6jb_
  
• d4h6jb1 was called d4h6jb_ in SCOPe 2.05
  
• d4h6jb1 appears in SCOPe 2.07
  
• d4h6jb1 appears in the current release, SCOPe 2.08